SCOP 1.55: Domain d1biia2: 1bii A:1-181

Lineage for d1biia2 (1bii A:1-181)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (3 PDB entries)

8. Domain d1biia2: 1bii A:1-181 [38311]
   Other proteins in same PDB: d1biia1, d1biib1

Details for d1biia2

PDB Entry: 1bii, 2.4 Å

PDB Description: the crystal structure of h-2dd mhc class i in complex with the hiv-1 derived peptide p18-110

SCOP Domain Sequences for d1biia2:

Sequence; same for both SEQRES and ATOM records:

>d1biia2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD}
gshslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeyw
eretrrakgneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydg
cdyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatll
r

Timeline for d1biia2:

• d1biia2 appears in SCOP 1.57
  
• d1biia2 appears in the current release, SCOPe 2.08