Lineage for d1qo3a2 (1qo3 A:2-181)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131823Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 131824Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 131825Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)
  6. 131843Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 131941Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (3 PDB entries)
  8. 131942Domain d1qo3a2: 1qo3 A:2-181 [38310]
    Other proteins in same PDB: d1qo3a1, d1qo3b1, d1qo3c_, d1qo3d_

Details for d1qo3a2

PDB Entry: 1qo3 (more details), 2.3 Å

PDB Description: complex between nk cell receptor ly49a and its mhc class i ligand h-2dd

SCOP Domain Sequences for d1qo3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo3a2 d.19.1.1 (A:2-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD}
shslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeywe
retrrakgneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydgc
dyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatllr

SCOP Domain Coordinates for d1qo3a2:

Click to download the PDB-style file with coordinates for d1qo3a2.
(The format of our PDB-style files is described here.)

Timeline for d1qo3a2: