Lineage for d1ldph2 (1ldp H:1-181)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020887Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1021264Species Mouse (Mus musculus), H-2LD [TaxId:10090] [54484] (2 PDB entries)
  8. 1021267Domain d1ldph2: 1ldp H:1-181 [38309]
    Other proteins in same PDB: d1ldph1, d1ldpl_
    complexed with ndg

Details for d1ldph2

PDB Entry: 1ldp (more details), 3.1 Å

PDB Description: crystal structure of murine mhc class i h-2ld with a mixture of bound peptides
PDB Compounds: (H:) MHC class I h-2ld

SCOPe Domain Sequences for d1ldph2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldph2 d.19.1.1 (H:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2LD [TaxId: 10090]}
gphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpeyw
eritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfaydg
cdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatll
r

SCOPe Domain Coordinates for d1ldph2:

Click to download the PDB-style file with coordinates for d1ldph2.
(The format of our PDB-style files is described here.)

Timeline for d1ldph2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ldph1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ldpl_