Lineage for d1ld9d2 (1ld9 D:1-181)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600255Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 600478Species Mouse (Mus musculus), H-2LD [TaxId:10090] [54484] (2 PDB entries)
  8. 600480Domain d1ld9d2: 1ld9 D:1-181 [38308]
    Other proteins in same PDB: d1ld9a1, d1ld9b_, d1ld9d1, d1ld9e_

Details for d1ld9d2

PDB Entry: 1ld9 (more details), 2.4 Å

PDB Description: the three-dimensional structure of an h-2ld peptide complex explains the unique interaction of ld with beta2m and peptide

SCOP Domain Sequences for d1ld9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ld9d2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2LD}
gphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpeyw
eritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfaydg
cdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatll
r

SCOP Domain Coordinates for d1ld9d2:

Click to download the PDB-style file with coordinates for d1ld9d2.
(The format of our PDB-style files is described here.)

Timeline for d1ld9d2: