SCOP 1.67: Domain d1ld9a2: 1ld9 A:1-181

Lineage for d1ld9a2 (1ld9 A:1-181)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species)

7. Species Mouse (Mus musculus), H-2LD [TaxId:10090] [54484] (2 PDB entries)

8. Domain d1ld9a2: 1ld9 A:1-181 [38307]
   Other proteins in same PDB: d1ld9a1, d1ld9b_, d1ld9d1, d1ld9e_

Details for d1ld9a2

PDB Entry: 1ld9, 2.4 Å

PDB Description: the three-dimensional structure of an h-2ld peptide complex explains the unique interaction of ld with beta2m and peptide

SCOP Domain Sequences for d1ld9a2:

Sequence; same for both SEQRES and ATOM records:

>d1ld9a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2LD}
gphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpeyw
eritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfaydg
cdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatll
r

Timeline for d1ld9a2:

• d1ld9a2 first appeared (with stable ids) in SCOP 1.55
  
• d1ld9a2 appears in SCOP 1.65
  
• d1ld9a2 appears in SCOP 1.69
  
• d1ld9a2 appears in the current release, SCOPe 2.08