Lineage for d1ld9a2 (1ld9 A:1-181)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255238Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 255391Species Mouse (Mus musculus), H-2LD [TaxId:10090] [54484] (2 PDB entries)
  8. 255392Domain d1ld9a2: 1ld9 A:1-181 [38307]
    Other proteins in same PDB: d1ld9a1, d1ld9b_, d1ld9d1, d1ld9e_

Details for d1ld9a2

PDB Entry: 1ld9 (more details), 2.4 Å

PDB Description: the three-dimensional structure of an h-2ld peptide complex explains the unique interaction of ld with beta2m and peptide

SCOP Domain Sequences for d1ld9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ld9a2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2LD}
gphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpeyw
eritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfaydg
cdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatll
r

SCOP Domain Coordinates for d1ld9a2:

Click to download the PDB-style file with coordinates for d1ld9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ld9a2: