Lineage for d1mhcd2 (1mhc D:1-181)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501142Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (21 species)
  7. 501351Species Mouse (Mus musculus), H-2M3 [TaxId:10090] [54483] (1 PDB entry)
  8. 501353Domain d1mhcd2: 1mhc D:1-181 [38306]
    Other proteins in same PDB: d1mhca1, d1mhcb_, d1mhcd1, d1mhce_

Details for d1mhcd2

PDB Entry: 1mhc (more details), 2.1 Å

PDB Description: model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution

SCOP Domain Sequences for d1mhcd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhcd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2M3}
gshslryfhtavsrpgrgepqyisvgyvddvqfqrcdsieeiprmeprapwmekerpeyw
kelklkvkniaqsaranlrtllryynqseggshilqwmvscevgpdmrllgahyqaaydg
sdyitlnedlsswtavdmvsqitksrlesagtaeyfrayvegeclellhrflrngkeilq
r

SCOP Domain Coordinates for d1mhcd2:

Click to download the PDB-style file with coordinates for d1mhcd2.
(The format of our PDB-style files is described here.)

Timeline for d1mhcd2: