Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species) |
Species Mouse (Mus musculus), H-2M3 [TaxId:10090] [54483] (1 PDB entry) |
Domain d1mhca2: 1mhc A:1-181 [38305] Other proteins in same PDB: d1mhca1, d1mhcb_, d1mhcd1, d1mhce_ |
PDB Entry: 1mhc (more details), 2.1 Å
SCOP Domain Sequences for d1mhca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mhca2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2M3} gshslryfhtavsrpgrgepqyisvgyvddvqfqrcdsieeiprmeprapwmekerpeyw kelklkvkniaqsaranlrtllryynqseggshilqwmvscevgpdmrllgahyqaaydg sdyitlnedlsswtavdmvsqitksrlesagtaeyfrayvegeclellhrflrngkeilq r
Timeline for d1mhca2:
View in 3D Domains from other chains: (mouse over for more information) d1mhcb_, d1mhcd1, d1mhcd2, d1mhce_ |