Lineage for d6ocad_ (6oca D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2371650Species Vicugna pacos [TaxId:30538] [276396] (23 PDB entries)
  8. 2371662Domain d6ocad_: 6oca D: [383041]
    Other proteins in same PDB: d6ocaa_, d6ocab_
    automated match to d1wz1h_
    complexed with cl, edo, pg4

Details for d6ocad_

PDB Entry: 6oca (more details), 2.11 Å

PDB Description: ricin a chain bound to vhh antibody v2g10
PDB Compounds: (D:) VHH antibody V2G10

SCOPe Domain Sequences for d6ocad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ocad_ b.1.1.0 (D:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlvetgggvvqaggslrlscvasgrtfsvsgrtfsdhglgwfrqapgkerefvgsisws
vdgdatyytdlansvkgrftisgvnakntvylqmnslkpedtavyycaaglrggtyarti
yeydywgqgtqvtvslep

SCOPe Domain Coordinates for d6ocad_:

Click to download the PDB-style file with coordinates for d6ocad_.
(The format of our PDB-style files is described here.)

Timeline for d6ocad_: