Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [276396] (23 PDB entries) |
Domain d6ocad_: 6oca D: [383041] Other proteins in same PDB: d6ocaa_, d6ocab_ automated match to d1wz1h_ complexed with cl, edo, pg4 |
PDB Entry: 6oca (more details), 2.11 Å
SCOPe Domain Sequences for d6ocad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ocad_ b.1.1.0 (D:) automated matches {Vicugna pacos [TaxId: 30538]} vqlvetgggvvqaggslrlscvasgrtfsvsgrtfsdhglgwfrqapgkerefvgsisws vdgdatyytdlansvkgrftisgvnakntvylqmnslkpedtavyycaaglrggtyarti yeydywgqgtqvtvslep
Timeline for d6ocad_: