Lineage for d6oo0l2 (6oo0 L:108-212)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361228Species Cow (Bos taurus) [TaxId:9913] [225911] (2 PDB entries)
  8. 2361233Domain d6oo0l2: 6oo0 L:108-212 [383040]
    Other proteins in same PDB: d6oo0l1
    automated match to d1lila2
    complexed with mpd

Details for d6oo0l2

PDB Entry: 6oo0 (more details), 2.1 Å

PDB Description: crystal structure of bovine fab nc-cow1
PDB Compounds: (L:) NC-Cow1 light chain

SCOPe Domain Sequences for d6oo0l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oo0l2 b.1.1.2 (L:108-212) automated matches {Cow (Bos taurus) [TaxId: 9913]}
qpksppsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOPe Domain Coordinates for d6oo0l2:

Click to download the PDB-style file with coordinates for d6oo0l2.
(The format of our PDB-style files is described here.)

Timeline for d6oo0l2: