Lineage for d1fg2d2 (1fg2 D:2-181)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31179Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)
  7. 31251Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (5 PDB entries)
  8. 31256Domain d1fg2d2: 1fg2 D:2-181 [38301]
    Other proteins in same PDB: d1fg2a1, d1fg2b1, d1fg2d1, d1fg2e1, d1fg2g1, d1fg2h1, d1fg2j1, d1fg2k1

Details for d1fg2d2

PDB Entry: 1fg2 (more details), 2.75 Å

PDB Description: crystal structure of the lcmv peptidic epitope gp33 in complex with the murine class i mhc molecule h-2db

SCOP Domain Sequences for d1fg2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fg2d2 d.19.1.1 (D:2-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

SCOP Domain Coordinates for d1fg2d2:

Click to download the PDB-style file with coordinates for d1fg2d2.
(The format of our PDB-style files is described here.)

Timeline for d1fg2d2: