Lineage for d1qlfa2 (1qlf A:1-181)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190321Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 190408Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (9 PDB entries)
  8. 190414Domain d1qlfa2: 1qlf A:1-181 [38298]
    Other proteins in same PDB: d1qlfa1, d1qlfb1

Details for d1qlfa2

PDB Entry: 1qlf (more details), 2.65 Å

PDB Description: mhc class i h-2db complexed with glycopeptide k3g

SCOP Domain Sequences for d1qlfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlfa2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOP Domain Coordinates for d1qlfa2:

Click to download the PDB-style file with coordinates for d1qlfa2.
(The format of our PDB-style files is described here.)

Timeline for d1qlfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qlfa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1qlfb1