Lineage for d2ckbh2 (2ckb H:1-181)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins) Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species) 
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (15 PDB entries) 
Domain d2ckbh2: 2ckb H:1-181 [38293]
Other proteins in same PDB: d2ckba1, d2ckba2, d2ckbb1, d2ckbb2, d2ckbc1, d2ckbc2, d2ckbd1, d2ckbd2, d2ckbh1, d2ckbi1, d2ckbl1, d2ckbm1
Details for d2ckbh2
PDB Entry: 2ckb (more details), 3.2 Å
PDB Description: structure of the 2c/kb/dev8 complex
SCOP Domain Sequences for d2ckbh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ckbh2 d.19.1.1 (H:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r
SCOP Domain Coordinates for d2ckbh2:
Click to download the PDB-style file with coordinates for d2ckbh2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ckbh2:
View in 3D
