Lineage for d2mhac2 (2mha C:1-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198345Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)
    Uniprot P01901 22-299
  8. 1198387Domain d2mhac2: 2mha C:1-181 [38292]
    Other proteins in same PDB: d2mhaa1, d2mhab_, d2mhac1, d2mhad_

Details for d2mhac2

PDB Entry: 2mha (more details), 2.5 Å

PDB Description: crystal structure of the major histocompatibility complex class i h-2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition
PDB Compounds: (C:) class I histocompatibility antigen (h-2kb) (alpha chain)

SCOPe Domain Sequences for d2mhac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mhac2 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d2mhac2:

Click to download the PDB-style file with coordinates for d2mhac2.
(The format of our PDB-style files is described here.)

Timeline for d2mhac2: