Lineage for d1bqhd2 (1bqh D:1-181)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255238Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 255359Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (23 PDB entries)
  8. 255378Domain d1bqhd2: 1bqh D:1-181 [38290]
    Other proteins in same PDB: d1bqha1, d1bqhb_, d1bqhd1, d1bqhe_, d1bqhg_, d1bqhh_, d1bqhi_, d1bqhk_
    complexed with nag

Details for d1bqhd2

PDB Entry: 1bqh (more details), 2.8 Å

PDB Description: murine cd8aa ectodomain fragment in complex with h-2kb/vsv8

SCOP Domain Sequences for d1bqhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqhd2 d.19.1.1 (D:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d1bqhd2:

Click to download the PDB-style file with coordinates for d1bqhd2.
(The format of our PDB-style files is described here.)

Timeline for d1bqhd2: