Lineage for d1osza2 (1osz A:1-181)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020887Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1021201Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)
    Uniprot P01901 22-299
  8. 1021231Domain d1osza2: 1osz A:1-181 [38287]
    Other proteins in same PDB: d1osza1, d1oszb_
    mutant

Details for d1osza2

PDB Entry: 1osz (more details), 2.1 Å

PDB Description: mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and an (l4v) mutant of the vesicular stomatitis virus nucleoprotein
PDB Compounds: (A:) MHC class I h-2kb heavy chain

SCOPe Domain Sequences for d1osza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1osza2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d1osza2:

Click to download the PDB-style file with coordinates for d1osza2.
(The format of our PDB-style files is described here.)

Timeline for d1osza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1osza1
View in 3D
Domains from other chains:
(mouse over for more information)
d1oszb_