SCOPe 2.08: Domain d6oc8c1: 6oc8 C:6-125

Lineage for d6oc8c1 (6oc8 C:6-125)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
Domain d6oc8c1: 6oc8 C:6-125 [382862]
Other proteins in same PDB: d6oc8a2, d6oc8b2, d6oc8c2, d6oc8d2
automated match to d4w81a_
complexed with gol, so4

Details for d6oc8c1

PDB Entry: 6oc8 (more details), 2.11 Å

PDB Description: crystal structure of a vhh against the capsid protein from blv

PDB Compounds: (C:) VHH8c

SCOPe Domain Sequences for d6oc8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oc8c1 b.1.1.1 (C:6-125) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlvesggglvqaggslrlscaasasifralnvgyyrqtpgrqreliagisgggsthya
dpvkgrftisrdnaknrvdlqmnnlkpedtavyycnagptlttgdagpywgqgtqvtvss

SCOPe Domain Coordinates for d6oc8c1:

Click to download the PDB-style file with coordinates for d6oc8c1.
(The format of our PDB-style files is described here.)

Timeline for d6oc8c1: