SCOPe 2.05: Domain d1kbgh2: 1kbg H:1-181

Lineage for d1kbgh2 (1kbg H:1-181)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (47 PDB entries)
   Uniprot P01901 22-299

8. Domain d1kbgh2: 1kbg H:1-181 [38286]
   Other proteins in same PDB: d1kbgh1, d1kbgl_
   complexed with nag

Details for d1kbgh2

PDB Entry: 1kbg, 2.2 Å

PDB Description: mhc class i h-2kb presented glycopeptide rgy8-6h-gal2

PDB Compounds: (H:) protein (major histocompatibility complex class I antigen h-2kb)

SCOPe Domain Sequences for d1kbgh2:

Sequence; same for both SEQRES and ATOM records:

>d1kbgh2 d.19.1.1 (H:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d1kbgh2:

• d1kbgh2 first appeared (with stable ids) in SCOP 1.55
  
• d1kbgh2 appears in SCOPe 2.04
  
• d1kbgh2 appears in SCOPe 2.06
  
• d1kbgh2 appears in the current release, SCOPe 2.08