Lineage for d1kbgh2 (1kbg H:1-181)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020887Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1021201Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)
    Uniprot P01901 22-299
  8. 1021226Domain d1kbgh2: 1kbg H:1-181 [38286]
    Other proteins in same PDB: d1kbgh1, d1kbgl_
    complexed with nag

Details for d1kbgh2

PDB Entry: 1kbg (more details), 2.2 Å

PDB Description: mhc class i h-2kb presented glycopeptide rgy8-6h-gal2
PDB Compounds: (H:) protein (major histocompatibility complex class I antigen h-2kb)

SCOPe Domain Sequences for d1kbgh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbgh2 d.19.1.1 (H:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d1kbgh2:

Click to download the PDB-style file with coordinates for d1kbgh2.
(The format of our PDB-style files is described here.)

Timeline for d1kbgh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kbgh1
View in 3D
Domains from other chains:
(mouse over for more information)
d1kbgl_