SCOPe 2.08: Domain d6tdpa1: 6tdp A:1-181

Lineage for d6tdpa1 (6tdp A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (9 PDB entries)

8. Domain d6tdpa1: 6tdp A:1-181 [382843]
   Other proteins in same PDB: d6tdpa2, d6tdpb_
   automated match to d4l29a1
   complexed with gly, gol, leu, na

Details for d6tdpa1

PDB Entry: 6tdp, 1.4 Å

PDB Description: crystal structure of the disulfide engineered hla-a0201 molecule in complex with one gl dipeptide in the a pocket.

PDB Compounds: (A:) MHC class I antigen

SCOPe Domain Sequences for d6tdpa1:

Sequence; same for both SEQRES and ATOM records:

>d6tdpa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgcynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmcaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d6tdpa1:

• d6tdpa1 first appeared in SCOPe 2.07