![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) ![]() automatically mapped to Pfam PF02935 |
![]() | Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins) |
![]() | Protein automated matches [191231] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [189652] (3 PDB entries) |
![]() | Domain d6juwy_: 6juw Y: [382842] Other proteins in same PDB: d6juwa_, d6juwb1, d6juwb2, d6juwc_, d6juwd_, d6juwe_, d6juwf_, d6juwg_, d6juwh_, d6juwi_, d6juwj_, d6juwk_, d6juwm_, d6juwn_, d6juwo1, d6juwo2, d6juwp_, d6juwq_, d6juwr_, d6juws_, d6juwt_, d6juwu_, d6juwv_, d6juww_, d6juwx_, d6juwz_ automated match to d2occl_ complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn |
PDB Entry: 6juw (more details), 1.8 Å
SCOPe Domain Sequences for d6juwy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6juwy_ f.23.6.1 (Y:) automated matches {Cow (Bos taurus) [TaxId: 9913]} hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
Timeline for d6juwy_:
![]() Domains from other chains: (mouse over for more information) d6juwa_, d6juwb1, d6juwb2, d6juwc_, d6juwd_, d6juwe_, d6juwf_, d6juwg_, d6juwh_, d6juwi_, d6juwj_, d6juwk_, d6juwl_, d6juwm_, d6juwn_, d6juwo1, d6juwo2, d6juwp_, d6juwq_, d6juwr_, d6juws_, d6juwt_, d6juwu_, d6juwv_, d6juww_, d6juwx_, d6juwz_ |