SCOP 1.69: Domain d2vaaa2: 2vaa A:1-181

Lineage for d2vaaa2 (2vaa A:1-181)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (21 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (34 PDB entries)

8. Domain d2vaaa2: 2vaa A:1-181 [38282]
   Other proteins in same PDB: d2vaaa1, d2vaab_

Details for d2vaaa2

PDB Entry: 2vaa, 2.3 Å

PDB Description: mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein

PDB Compounds: (A:)

SCOP Domain Sequences for d2vaaa2:

Sequence; same for both SEQRES and ATOM records:

>d2vaaa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d2vaaa2:

• d2vaaa2 first appeared (with stable ids) in SCOP 1.55
  
• d2vaaa2 appears in SCOP 1.67
  
• d2vaaa2 appears in SCOP 1.71
  
• d2vaaa2 appears in the current release, SCOPe 2.07