Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Hemochromatosis protein Hfe, alpha-1 and alpha-2 domains [88832] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54480] (2 PDB entries) |
Domain d1a6zc2: 1a6z C:4-181 [38281] Other proteins in same PDB: d1a6za1, d1a6zb_, d1a6zc1, d1a6zd_ |
PDB Entry: 1a6z (more details), 2.6 Å
SCOPe Domain Sequences for d1a6zc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6zc2 d.19.1.1 (C:4-181) Hemochromatosis protein Hfe, alpha-1 and alpha-2 domains {Human (Homo sapiens) [TaxId: 9606]} rshslhylfmgaseqdlglslfealgyvddqlfvfydhesrrveprtpwvssrissqmwl qlsqslkgwdhmftvdfwtimenhnhskeshtlqvilgcemqednstegywkygydgqdh lefcpdtldwraaeprawptklewerhkirarqnraylerdcpaqlqqllelgrgvld
Timeline for d1a6zc2:
View in 3D Domains from other chains: (mouse over for more information) d1a6za1, d1a6za2, d1a6zb_, d1a6zd_ |