Lineage for d1a6za2 (1a6z A:4-181)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131823Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 131824Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 131825Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)
  6. 131843Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 131844Species Human (Homo sapiens), hemochromatosis protein Hfe [TaxId:9606] [54480] (2 PDB entries)
  8. 131848Domain d1a6za2: 1a6z A:4-181 [38280]
    Other proteins in same PDB: d1a6za1, d1a6zb1, d1a6zc1, d1a6zd1

Details for d1a6za2

PDB Entry: 1a6z (more details), 2.6 Å

PDB Description: hfe (human) hemochromatosis protein

SCOP Domain Sequences for d1a6za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6za2 d.19.1.1 (A:4-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), hemochromatosis protein Hfe}
rshslhylfmgaseqdlglslfealgyvddqlfvfydhesrrveprtpwvssrissqmwl
qlsqslkgwdhmftvdfwtimenhnhskeshtlqvilgcemqednstegywkygydgqdh
lefcpdtldwraaeprawptklewerhkirarqnraylerdcpaqlqqllelgrgvld

SCOP Domain Coordinates for d1a6za2:

Click to download the PDB-style file with coordinates for d1a6za2.
(The format of our PDB-style files is described here.)

Timeline for d1a6za2: