Lineage for d1a6za2 (1a6z A:4-181)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78647Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 78648Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 78649Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 78661Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)
  7. 78662Species Human (Homo sapiens), hemochromatosis protein Hfe [TaxId:9606] [54480] (2 PDB entries)
  8. 78666Domain d1a6za2: 1a6z A:4-181 [38280]
    Other proteins in same PDB: d1a6za1, d1a6zb1, d1a6zc1, d1a6zd1

Details for d1a6za2

PDB Entry: 1a6z (more details), 2.6 Å

PDB Description: hfe (human) hemochromatosis protein

SCOP Domain Sequences for d1a6za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6za2 d.19.1.1 (A:4-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), hemochromatosis protein Hfe}
rshslhylfmgaseqdlglslfealgyvddqlfvfydhesrrveprtpwvssrissqmwl
qlsqslkgwdhmftvdfwtimenhnhskeshtlqvilgcemqednstegywkygydgqdh
lefcpdtldwraaeprawptklewerhkirarqnraylerdcpaqlqqllelgrgvld

SCOP Domain Coordinates for d1a6za2:

Click to download the PDB-style file with coordinates for d1a6za2.
(The format of our PDB-style files is described here.)

Timeline for d1a6za2: