![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins) |
![]() | Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species) |
![]() | Species Human (Homo sapiens), hemochromatosis protein Hfe [TaxId:9606] [54480] (2 PDB entries) |
![]() | Domain d1a6za2: 1a6z A:4-181 [38280] Other proteins in same PDB: d1a6za1, d1a6zb1, d1a6zc1, d1a6zd1 |
PDB Entry: 1a6z (more details), 2.6 Å
SCOP Domain Sequences for d1a6za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6za2 d.19.1.1 (A:4-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), hemochromatosis protein Hfe} rshslhylfmgaseqdlglslfealgyvddqlfvfydhesrrveprtpwvssrissqmwl qlsqslkgwdhmftvdfwtimenhnhskeshtlqvilgcemqednstegywkygydgqdh lefcpdtldwraaeprawptklewerhkirarqnraylerdcpaqlqqllelgrgvld
Timeline for d1a6za2:
![]() Domains from other chains: (mouse over for more information) d1a6zb1, d1a6zc1, d1a6zc2, d1a6zd1 |