SCOPe 2.08: Domain d6juwp_: 6juw P:

Lineage for d6juwp_ (6juw P:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families)
   automatically mapped to Pfam PF00510

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries)

8. Domain d6juwp_: 6juw P: [382789]
   Other proteins in same PDB: d6juwa_, d6juwb1, d6juwb2, d6juwd_, d6juwe_, d6juwf_, d6juwg_, d6juwh_, d6juwi_, d6juwj_, d6juwk_, d6juwl_, d6juwm_, d6juwn_, d6juwo1, d6juwo2, d6juwq_, d6juwr_, d6juws_, d6juwt_, d6juwu_, d6juwv_, d6juww_, d6juwx_, d6juwy_, d6juwz_
   automated match to d3ag3c_
   complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d6juwp_

PDB Entry: 6juw, 1.8 Å

PDB Description: bovine heart cytochrome c oxidase in catalitic intermediates at 1.80 angstrom resolution

PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d6juwp_:

Sequence; same for both SEQRES and ATOM records:

>d6juwp_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

Timeline for d6juwp_:

• d6juwp_ first appeared in SCOPe 2.07