Lineage for d6juwu_ (6juw U:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714739Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2714740Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2714741Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2714742Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 2714743Species Cow (Bos taurus) [TaxId:9913] [47697] (33 PDB entries)
  8. 2714767Domain d6juwu_: 6juw U: [382763]
    Other proteins in same PDB: d6juwa_, d6juwb1, d6juwb2, d6juwc_, d6juwd_, d6juwe_, d6juwf_, d6juwg_, d6juwi_, d6juwj_, d6juwk_, d6juwl_, d6juwm_, d6juwn_, d6juwo1, d6juwo2, d6juwp_, d6juwq_, d6juwr_, d6juws_, d6juwt_, d6juwv_, d6juww_, d6juwx_, d6juwy_, d6juwz_
    automated match to d1v54h_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d6juwu_

PDB Entry: 6juw (more details), 1.8 Å

PDB Description: bovine heart cytochrome c oxidase in catalitic intermediates at 1.80 angstrom resolution
PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d6juwu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6juwu_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d6juwu_:

Click to download the PDB-style file with coordinates for d6juwu_.
(The format of our PDB-style files is described here.)

Timeline for d6juwu_: