SCOPe 2.07: Domain d6juwn_: 6juw N:

Lineage for d6juwn_ (6juw N:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81432] (35 PDB entries)

8. Domain d6juwn_: 6juw N: [382729]
   Other proteins in same PDB: d6juwb1, d6juwb2, d6juwc_, d6juwd_, d6juwe_, d6juwf_, d6juwg_, d6juwh_, d6juwi_, d6juwj_, d6juwk_, d6juwl_, d6juwm_, d6juwo1, d6juwo2, d6juwp_, d6juwq_, d6juwr_, d6juws_, d6juwt_, d6juwu_, d6juwv_, d6juww_, d6juwx_, d6juwy_, d6juwz_
   automated match to d1v54a_
   complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d6juwn_

PDB Entry: 6juw, 1.8 Å

PDB Description: bovine heart cytochrome c oxidase in catalitic intermediates at 1.80 angstrom resolution

PDB Compounds: (N:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d6juwn_:

Sequence; same for both SEQRES and ATOM records:

>d6juwn_ f.24.1.1 (N:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

Timeline for d6juwn_:

• d6juwn_ is new in SCOPe 2.07-stable
  
• d6juwn_ appears in the current release, SCOPe 2.08