Lineage for d1e28a2 (1e28 A:1-181)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020887Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1021046Species Human (Homo sapiens), HLA-B51 [TaxId:9606] [54476] (2 PDB entries)
  8. 1021048Domain d1e28a2: 1e28 A:1-181 [38272]
    Other proteins in same PDB: d1e28a1, d1e28b_

Details for d1e28a2

PDB Entry: 1e28 (more details), 3 Å

PDB Description: nonstandard peptide binding of hla-b*5101 complexed with hiv immunodominant epitope km2(taftipsi)
PDB Compounds: (A:) hla class I histocompatibility antigen heavy chain

SCOPe Domain Sequences for d1e28a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e28a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B51 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprppwieqegpeyw
drntqifktntqtyrenlrialryynqseagshtwqtmygcdvgpdgrllrghnqyaydg
kdyialnedlsswtaadtaaqitqrkweaareaeqlrayleglcvewlrrhlengketlq
r

SCOPe Domain Coordinates for d1e28a2:

Click to download the PDB-style file with coordinates for d1e28a2.
(The format of our PDB-style files is described here.)

Timeline for d1e28a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e28a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1e28b_