![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
![]() | Species Human (Homo sapiens), HLA-B51 [TaxId:9606] [54476] (2 PDB entries) |
![]() | Domain d1e27a2: 1e27 A:1-181 [38271] Other proteins in same PDB: d1e27a1, d1e27b_ |
PDB Entry: 1e27 (more details), 2.2 Å
SCOPe Domain Sequences for d1e27a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e27a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B51 [TaxId: 9606]} gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw drntqifktntqtyrenlrialryynqseagshtwqtmygcdvgpdgrllrghnqyaydg kdyialnedlsswtaadtaaqitqrkweaareaeqlrayleglcvewlrrhlengketlq r
Timeline for d1e27a2: