Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (13 PDB entries) Uniprot P30685 25-300 |
Domain d1a9bd2: 1a9b D:1-181 [38270] Other proteins in same PDB: d1a9ba1, d1a9bb2, d1a9bb3, d1a9bd1, d1a9be2, d1a9be3 |
PDB Entry: 1a9b (more details), 3.2 Å
SCOPe Domain Sequences for d1a9bd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a9bd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]} gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq r
Timeline for d1a9bd2: