Lineage for d1a9bd2 (1a9b D:1-181)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1641840Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1642042Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (13 PDB entries)
    Uniprot P30685 25-300
  8. 1642055Domain d1a9bd2: 1a9b D:1-181 [38270]
    Other proteins in same PDB: d1a9ba1, d1a9bb_, d1a9bd1, d1a9be_

Details for d1a9bd2

PDB Entry: 1a9b (more details), 3.2 Å

PDB Description: decamer-like conformation of a nano-peptide bound to hla-b3501 due to nonstandard positioning of the c-terminus
PDB Compounds: (D:) hla class I histocompatibility antigen, b-35 b*3501 (alpha chain)

SCOPe Domain Sequences for d1a9bd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9bd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1a9bd2:

Click to download the PDB-style file with coordinates for d1a9bd2.
(The format of our PDB-style files is described here.)

Timeline for d1a9bd2: