SCOP 1.55: Domain d1a9bd2: 1a9b D:1-181

Lineage for d1a9bd2 (1a9b D:1-181)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)

7. Species Human (Homo sapiens), HLA-B*3501 [TaxId:9606] [54475] (3 PDB entries)

8. Domain d1a9bd2: 1a9b D:1-181 [38270]
   Other proteins in same PDB: d1a9ba1, d1a9bb1, d1a9bd1, d1a9be1

Details for d1a9bd2

PDB Entry: 1a9b, 3.2 Å

PDB Description: decamer-like conformation of a nano-peptide bound to hla-b3501 due to nonstandard positioning of the c-terminus

SCOP Domain Sequences for d1a9bd2:

Sequence; same for both SEQRES and ATOM records:

>d1a9bd2 d.19.1.1 (D:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B*3501}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

Timeline for d1a9bd2:

• d1a9bd2 appears in SCOP 1.57
  
• d1a9bd2 appears in the current release, SCOPe 2.08