SCOPe 2.07: Domain d6joaa2: 6joa A:595-750

Lineage for d6joaa2 (6joa A:595-750)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (24 species)
   not a true protein

7. Species Escherichia coli [TaxId:1392854] [382571] (1 PDB entry)

8. Domain d6joaa2: 6joa A:595-750 [382693]
   Other proteins in same PDB: d6joaa1, d6joab1, d6joac1, d6joad1
   automated match to d3p9qa2
   complexed with edo, hem

Details for d6joaa2

PDB Entry: 6joa, 2.1 Å

PDB Description: crystal structure of kate from atypical escherichia coli

PDB Compounds: (A:) catalase

SCOPe Domain Sequences for d6joaa2:

Sequence; same for both SEQRES and ATOM records:

>d6joaa2 c.23.16.0 (A:595-750) automated matches {Escherichia coli [TaxId: 1392854]}
lksrqvailaadgvcgdaidnimktlkkygvhgkifaphvgritslqgneievngtiegn
psvmvdaviipdgedsidslmkngnakhyviqafkhlkaiglqgkafklydalplpkpde
givvgdkaadlaeafcnvmrghriwsresvaqeiag

Timeline for d6joaa2:

• d6joaa2 is new in SCOPe 2.07-stable
  
• d6joaa2 does not appear in SCOPe 2.08