SCOPe 2.03: Domain d1a9ba2: 1a9b A:1-181

Lineage for d1a9ba2 (1a9b A:1-181)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (12 PDB entries)
   Uniprot P30685 25-300

8. Domain d1a9ba2: 1a9b A:1-181 [38269]
   Other proteins in same PDB: d1a9ba1, d1a9bb_, d1a9bd1, d1a9be_

Details for d1a9ba2

PDB Entry: 1a9b, 3.2 Å

PDB Description: decamer-like conformation of a nano-peptide bound to hla-b3501 due to nonstandard positioning of the c-terminus

PDB Compounds: (A:) hla class I histocompatibility antigen, b-35 b*3501 (alpha chain)

SCOPe Domain Sequences for d1a9ba2:

Sequence; same for both SEQRES and ATOM records:

>d1a9ba2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

Timeline for d1a9ba2:

• d1a9ba2 first appeared (with stable ids) in SCOP 1.55
  
• d1a9ba2 appears in SCOPe 2.02
  
• d1a9ba2 appears in SCOPe 2.04
  
• d1a9ba2 appears in the current release, SCOPe 2.08