| Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
| Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species) |
| Species Human (Homo sapiens), HLA-B*3501 [TaxId:9606] [54475] (3 PDB entries) |
| Domain d1a9ba2: 1a9b A:1-181 [38269] Other proteins in same PDB: d1a9ba1, d1a9bb1, d1a9bd1, d1a9be1 |
PDB Entry: 1a9b (more details), 3.2 Å
SCOP Domain Sequences for d1a9ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a9ba2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B*3501}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r
Timeline for d1a9ba2:
View in 3DDomains from other chains: (mouse over for more information) d1a9bb1, d1a9bd1, d1a9bd2, d1a9be1 |