Lineage for d1a9ba2 (1a9b A:1-181)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31179Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)
  7. 31224Species Human (Homo sapiens), HLA-B*3501 [TaxId:9606] [54475] (3 PDB entries)
  8. 31227Domain d1a9ba2: 1a9b A:1-181 [38269]
    Other proteins in same PDB: d1a9ba1, d1a9bb1, d1a9bd1, d1a9be1

Details for d1a9ba2

PDB Entry: 1a9b (more details), 3.2 Å

PDB Description: decamer-like conformation of a nano-peptide bound to hla-b3501 due to nonstandard positioning of the c-terminus

SCOP Domain Sequences for d1a9ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9ba2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B*3501}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

SCOP Domain Coordinates for d1a9ba2:

Click to download the PDB-style file with coordinates for d1a9ba2.
(The format of our PDB-style files is described here.)

Timeline for d1a9ba2: