Lineage for d1a9ea2 (1a9e A:1-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198183Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (5 PDB entries)
    Uniprot P30685 25-300
  8. 1198186Domain d1a9ea2: 1a9e A:1-181 [38268]
    Other proteins in same PDB: d1a9ea1, d1a9eb_

Details for d1a9ea2

PDB Entry: 1a9e (more details), 2.5 Å

PDB Description: decamer-like conformation of a nano-peptide bound to hla-b3501 due to nonstandard positioning of the c-terminus
PDB Compounds: (A:) hla class I histocompatibility antigen, b-35 b*3501 (alpha chain)

SCOPe Domain Sequences for d1a9ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9ea2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1a9ea2:

Click to download the PDB-style file with coordinates for d1a9ea2.
(The format of our PDB-style files is described here.)

Timeline for d1a9ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a9ea1
View in 3D
Domains from other chains:
(mouse over for more information)
d1a9eb_