| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
| Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (5 PDB entries) Uniprot P30685 25-300 |
| Domain d1a9ea2: 1a9e A:1-181 [38268] Other proteins in same PDB: d1a9ea1, d1a9eb_ |
PDB Entry: 1a9e (more details), 2.5 Å
SCOP Domain Sequences for d1a9ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a9ea2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r
Timeline for d1a9ea2: