SCOP 1.63: Domain d1a1na2: 1a1n A:1-181

Lineage for d1a1na2 (1a1n A:1-181)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)

7. Species Human (Homo sapiens), HLA-B*3501 [TaxId:9606] [54475] (3 PDB entries)

8. Domain d1a1na2: 1a1n A:1-181 [38267]
   Other proteins in same PDB: d1a1na1, d1a1nb_

Details for d1a1na2

PDB Entry: 1a1n, 2 Å

PDB Description: mhc class i molecule b*3501 complexed with peptide vplrpmty from the nef protein (75-82) of hiv1

SCOP Domain Sequences for d1a1na2:

Sequence; same for both SEQRES and ATOM records:

>d1a1na2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B*3501}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprppwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

Timeline for d1a1na2:

• d1a1na2 first appeared (with stable ids) in SCOP 1.55
  
• d1a1na2 appears in SCOP 1.61
  
• d1a1na2 appears in SCOP 1.65
  
• d1a1na2 appears in the current release, SCOPe 2.08