Lineage for d1a1ma2 (1a1m A:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2544976Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (23 PDB entries)
  8. 2544996Domain d1a1ma2: 1a1m A:1-181 [38266]
    Other proteins in same PDB: d1a1ma1, d1a1mb_

Details for d1a1ma2

PDB Entry: 1a1m (more details), 2.3 Å

PDB Description: mhc class i molecule b*5301 complexed with peptide tpydinqml from gag protein of hiv2
PDB Compounds: (A:) HLA class I histocompatibility antigen, BW-53 B*5301 alpha chain

SCOPe Domain Sequences for d1a1ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a1ma2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprppwieqegpeyw
drntqifktntqtyrenlrialryynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1a1ma2:

Click to download the PDB-style file with coordinates for d1a1ma2.
(The format of our PDB-style files is described here.)

Timeline for d1a1ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a1ma1
View in 3D
Domains from other chains:
(mouse over for more information)
d1a1mb_