Lineage for d6lfjb1 (6lfj B:78-207)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002670Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries)
  8. 3002680Domain d6lfjb1: 6lfj B:78-207 [382640]
    Other proteins in same PDB: d6lfja2, d6lfjb2
    automated match to d1ypof_
    complexed with b3p, ca, ipd, man

Details for d6lfjb1

PDB Entry: 6lfj (more details), 1.84 Å

PDB Description: crystal structure of mouse dcar2 crd domain complex with ipm2
PDB Compounds: (B:) C-type lectin domain family 4, member b1

SCOPe Domain Sequences for d6lfjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lfjb1 d.169.1.0 (B:78-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cpkdwklfgshcylvptvfssaswnkseencsrmgahlvvihsqeeqdfitgildihaay
figlwdtghrqwqwvdqtpyeesvtfwhngepssdnekcvtvyyrrnigwgwndiscnlk
qksvcqmkki

SCOPe Domain Coordinates for d6lfjb1:

Click to download the PDB-style file with coordinates for d6lfjb1.
(The format of our PDB-style files is described here.)

Timeline for d6lfjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6lfjb2