Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries) |
Domain d6lfjb1: 6lfj B:78-207 [382640] Other proteins in same PDB: d6lfja2, d6lfjb2 automated match to d1ypof_ complexed with b3p, ca, ipd, man |
PDB Entry: 6lfj (more details), 1.84 Å
SCOPe Domain Sequences for d6lfjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lfjb1 d.169.1.0 (B:78-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]} cpkdwklfgshcylvptvfssaswnkseencsrmgahlvvihsqeeqdfitgildihaay figlwdtghrqwqwvdqtpyeesvtfwhngepssdnekcvtvyyrrnigwgwndiscnlk qksvcqmkki
Timeline for d6lfjb1: