Lineage for d1agba2 (1agb A:1-181)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719393Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 719507Species Human (Homo sapiens), HLA-B08 [TaxId:9606] [54473] (7 PDB entries)
  8. 719514Domain d1agba2: 1agb A:1-181 [38263]
    Other proteins in same PDB: d1agba1, d1agbb_
    mutant

Details for d1agba2

PDB Entry: 1agb (more details), 2.2 Å

PDB Description: antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggrkkykl-3r mutation)
PDB Compounds: (A:) b*0801

SCOP Domain Sequences for d1agba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agba2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B08 [TaxId: 9606]}
gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaaspreeprapwieqegpeyw
drntqifktntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydg
kdyialnedlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtle
r

SCOP Domain Coordinates for d1agba2:

Click to download the PDB-style file with coordinates for d1agba2.
(The format of our PDB-style files is described here.)

Timeline for d1agba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1agba1
View in 3D
Domains from other chains:
(mouse over for more information)
d1agbb_