![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
![]() | Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species) |
![]() | Species Human (Homo sapiens), HLA-B0801 [TaxId:9606] [54473] (6 PDB entries) |
![]() | Domain d1agba2: 1agb A:1-181 [38263] Other proteins in same PDB: d1agba1, d1agbb_ mutant |
PDB Entry: 1agb (more details), 2.2 Å
SCOP Domain Sequences for d1agba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1agba2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B0801} gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaaspreeprapwieqegpeyw drntqifktntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydg kdyialnedlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtle r
Timeline for d1agba2: