Lineage for d1agfa2 (1agf A:1-181)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501142Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (21 species)
  7. 501211Species Human (Homo sapiens), HLA-B08 [TaxId:9606] [54473] (7 PDB entries)
  8. 501216Domain d1agfa2: 1agf A:1-181 [38262]
    Other proteins in same PDB: d1agfa1, d1agfb_

Details for d1agfa2

PDB Entry: 1agf (more details), 2.2 Å

PDB Description: antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggkkrykl-5r mutation)

SCOP Domain Sequences for d1agfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agfa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B08}
gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaaspreeprapwieqegpeyw
drntqifktntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydg
kdyialnedlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtle
r

SCOP Domain Coordinates for d1agfa2:

Click to download the PDB-style file with coordinates for d1agfa2.
(The format of our PDB-style files is described here.)

Timeline for d1agfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1agfa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1agfb_