Lineage for d1agca2 (1agc A:1-181)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1641840Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1642022Species Human (Homo sapiens), HLA-B08 [TaxId:9606] [54473] (7 PDB entries)
  8. 1642026Domain d1agca2: 1agc A:1-181 [38261]
    Other proteins in same PDB: d1agca1, d1agcb_
    mutant

Details for d1agca2

PDB Entry: 1agc (more details), 2.1 Å

PDB Description: antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggkkkyql-7q mutation)
PDB Compounds: (A:) b*0801

SCOPe Domain Sequences for d1agca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agca2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B08 [TaxId: 9606]}
gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaaspreeprapwieqegpeyw
drntqifktntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydg
kdyialnedlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtle
r

SCOPe Domain Coordinates for d1agca2:

Click to download the PDB-style file with coordinates for d1agca2.
(The format of our PDB-style files is described here.)

Timeline for d1agca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1agca1
View in 3D
Domains from other chains:
(mouse over for more information)
d1agcb_