Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Human (Homo sapiens), HLA-B08 [TaxId:9606] [54473] (7 PDB entries) |
Domain d1agca2: 1agc A:1-181 [38261] Other proteins in same PDB: d1agca1, d1agcb_ mutant |
PDB Entry: 1agc (more details), 2.1 Å
SCOPe Domain Sequences for d1agca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1agca2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B08 [TaxId: 9606]} gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaaspreeprapwieqegpeyw drntqifktntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydg kdyialnedlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtle r
Timeline for d1agca2: