SCOPe 2.08: Domain d1agca2: 1agc A:1-181

Lineage for d1agca2 (1agc A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-B08 [TaxId:9606] [54473] (7 PDB entries)

8. Domain d1agca2: 1agc A:1-181 [38261]
   Other proteins in same PDB: d1agca1, d1agcb_
   mutant

Details for d1agca2

PDB Entry: 1agc, 2.1 Å

PDB Description: antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggkkkyql-7q mutation)

PDB Compounds: (A:) b*0801

SCOPe Domain Sequences for d1agca2:

Sequence; same for both SEQRES and ATOM records:

>d1agca2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B08 [TaxId: 9606]}
gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaaspreeprapwieqegpeyw
drntqifktntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydg
kdyialnedlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtle
r

Timeline for d1agca2:

• d1agca2 first appeared (with stable ids) in SCOP 1.55
  
• d1agca2 appears in SCOPe 2.07