Lineage for d1agda2 (1agd A:1-181)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326693Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 326694Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 326695Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 326714Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 326771Species Human (Homo sapiens), HLA-B08 [TaxId:9606] [54473] (6 PDB entries)
  8. 326772Domain d1agda2: 1agd A:1-181 [38260]
    Other proteins in same PDB: d1agda1, d1agdb_

Details for d1agda2

PDB Entry: 1agd (more details), 2.05 Å

PDB Description: antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggkkkykl-index peptide)

SCOP Domain Sequences for d1agda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agda2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B08}
gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaaspreeprapwieqegpeyw
drntqifktntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydg
kdyialnedlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtle
r

SCOP Domain Coordinates for d1agda2:

Click to download the PDB-style file with coordinates for d1agda2.
(The format of our PDB-style files is described here.)

Timeline for d1agda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1agda1
View in 3D
Domains from other chains:
(mouse over for more information)
d1agdb_