SCOP 1.63: Domain d1agda2: 1agd A:1-181

Lineage for d1agda2 (1agd A:1-181)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)

7. Species Human (Homo sapiens), HLA-B0801 [TaxId:9606] [54473] (6 PDB entries)

8. Domain d1agda2: 1agd A:1-181 [38260]
   Other proteins in same PDB: d1agda1, d1agdb_

Details for d1agda2

PDB Entry: 1agd, 2.05 Å

PDB Description: antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggkkkykl-index peptide)

SCOP Domain Sequences for d1agda2:

Sequence; same for both SEQRES and ATOM records:

>d1agda2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B0801}
gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaaspreeprapwieqegpeyw
drntqifktntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydg
kdyialnedlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtle
r

Timeline for d1agda2:

• d1agda2 first appeared (with stable ids) in SCOP 1.55
  
• d1agda2 appears in SCOP 1.61
  
• d1agda2 appears in SCOP 1.65
  
• d1agda2 appears in the current release, SCOPe 2.08