Lineage for d1agda2 (1agd A:1-181)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31179Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)
  7. 31232Species Human (Homo sapiens), HLA-B0801 [TaxId:9606] [54473] (5 PDB entries)
  8. 31233Domain d1agda2: 1agd A:1-181 [38260]
    Other proteins in same PDB: d1agda1, d1agdb1

Details for d1agda2

PDB Entry: 1agd (more details), 2.05 Å

PDB Description: antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggkkkykl-index peptide)

SCOP Domain Sequences for d1agda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agda2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B0801}
gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaaspreeprapwieqegpeyw
drntqifktntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydg
kdyialnedlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtle
r

SCOP Domain Coordinates for d1agda2:

Click to download the PDB-style file with coordinates for d1agda2.
(The format of our PDB-style files is described here.)

Timeline for d1agda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1agda1
View in 3D
Domains from other chains:
(mouse over for more information)
d1agdb1